SCOPe 2.07: Domain d6de8b2: 6de8 B:120-281

Lineage for d6de8b2 (6de8 B:120-281)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:192222] [225997] (7 PDB entries)

8. Domain d6de8b2: 6de8 B:120-281 [352777]
   Other proteins in same PDB: d6de8a1, d6de8a3, d6de8b1, d6de8b3
   automated match to d3p2oa2
   complexed with cl, gol, iod, k

Details for d6de8b2

PDB Entry: 6de8, 2.1 Å

PDB Description: crystal structure of bifunctional enzyme fold- methylenetetrahydrofolate dehydrogenase/cyclohydrolase from campylobacter jejuni

PDB Compounds: (B:) Bifunctional protein folD

SCOPe Domain Sequences for d6de8b2:

Sequence; same for both SEQRES and ATOM records:

>d6de8b2 c.2.1.0 (B:120-281) automated matches {Campylobacter jejuni [TaxId: 192222]}
fhpinvgylnlglesgflpctplgvmkllkayeidlegkdaviigasnivgrpmatmlln
agatvsvchiktkdlslytrqadliivaagcvnllrsdmvkegvivvdvginrlesgkiv
gdvdfeevskkssyitpvpggvgpmtiamllentvksaknrl

Timeline for d6de8b2:

• d6de8b2 is new in SCOPe 2.07-stable
  
• d6de8b2 appears in the current release, SCOPe 2.08