SCOPe 2.07: Domain d5nria1: 5nri A:2-102

Lineage for d5nria1 (5nri A:2-102)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (39 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:320372] [226351] (3 PDB entries)

8. Domain d5nria1: 5nri A:2-102 [352974]
   Other proteins in same PDB: d5nria2, d5nrib2
   automated match to d4egqb1
   complexed with amp, dal, edo, mg, pge, so4

Details for d5nria1

PDB Entry: 5nri, 1.5 Å

PDB Description: crystal structure of burkholderia pseudomallei d-alanine-d-alanine ligase in complex with amp and d-ala-d-ala

PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d5nria1:

Sequence; same for both SEQRES and ATOM records:

>d5nria1 c.30.1.0 (A:2-102) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
sgidpkrfgkvavllggdsaerevslnsgrlvlqglrdagidahpfdpaqrplaalkdeg
fvrafnalhggygengqiqgaldfygirytgsgvlgsalgl

Timeline for d5nria1:

• d5nria1 is new in SCOPe 2.07-stable
  
• d5nria1 appears in the current release, SCOPe 2.08