Lineage for d5nria1 (5nri A:2-102)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2444095Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2444096Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2444442Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2444443Protein automated matches [226903] (37 species)
    not a true protein
  7. 2444465Species Burkholderia pseudomallei [TaxId:320372] [226351] (3 PDB entries)
  8. 3052912Domain d5nria1: 5nri A:2-102 [352974]
    Other proteins in same PDB: d5nria2, d5nrib2
    automated match to d4egqb1
    complexed with amp, dal, edo, mg, pge, so4

Details for d5nria1

PDB Entry: 5nri (more details), 1.5 Å

PDB Description: crystal structure of burkholderia pseudomallei d-alanine-d-alanine ligase in complex with amp and d-ala-d-ala
PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d5nria1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nria1 c.30.1.0 (A:2-102) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
sgidpkrfgkvavllggdsaerevslnsgrlvlqglrdagidahpfdpaqrplaalkdeg
fvrafnalhggygengqiqgaldfygirytgsgvlgsalgl

SCOPe Domain Coordinates for d5nria1:

Click to download the PDB-style file with coordinates for d5nria1.
(The format of our PDB-style files is described here.)

Timeline for d5nria1:

  • d5nria1 appears in periodic updates to SCOPe 2.07 starting on 2018-05-31

View in 3D
Domains from same chain:
(mouse over for more information)
d5nria2