SCOP 1.57: Domain d1oasb_: 1oas B:

Lineage for d1oasb_ (1oas B:)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (6 proteins)

6. Protein O-acetylserine sulfhydrylase (Cystein synthase) [53690] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [53691] (3 PDB entries)

8. Domain d1oasb_: 1oas B: [35294]

Details for d1oasb_

PDB Entry: 1oas, 2.2 Å

PDB Description: o-acetylserine sulfhydrylase from salmonella typhimurium

SCOP Domain Sequences for d1oasb_:

Sequence; same for both SEQRES and ATOM records:

>d1oasb_ c.79.1.1 (B:) O-acetylserine sulfhydrylase (Cystein synthase) {Salmonella typhimurium}
skiyednsltightplvrlnrigngrilakvesrnpsfsvkcriganmiwdaekrgvlkp
gvelveptngntgialayvaaargykltltmpetmsierrkllkalganlvltegakgmk
gaiqkaeeivasdpqkylllqqfsnpanpeihekttgpeiwedtdgqvdvfisgvgtggt
ltgvtryikgtkgktdlitvaveptdspviaqalageeikpgphkiqgigagfipgnldl
klidkvvgitneeaistarrlmeeegilagissgaavaaalklqedesftnknivvilps
sgerylstalfadlf

Timeline for d1oasb_:

• d1oasb_ first appeared (with stable ids) in SCOP 1.55
  
• d1oasb_ appears in SCOP 1.59
  
• d1oasb_ appears in the current release, SCOPe 2.08