Lineage for d1oasb_ (1oas B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) 
Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (4 proteins) 
Protein O-acetylserine sulfhydrylase (Cystein synthase) [53690] (1 species) Species Salmonella typhimurium [TaxId:90371] [53691] (3 PDB entries) 
Domain d1oasb_: 1oas B: [35294]
Details for d1oasb_
PDB Entry: 1oas (more details), 2.2 Å
PDB Description: o-acetylserine sulfhydrylase from salmonella typhimurium
SCOP Domain Sequences for d1oasb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oasb_ c.79.1.1 (B:) O-acetylserine sulfhydrylase (Cystein synthase) {Salmonella typhimurium}
skiyednsltightplvrlnrigngrilakvesrnpsfsvkcriganmiwdaekrgvlkp
gvelveptngntgialayvaaargykltltmpetmsierrkllkalganlvltegakgmk
gaiqkaeeivasdpqkylllqqfsnpanpeihekttgpeiwedtdgqvdvfisgvgtggt
ltgvtryikgtkgktdlitvaveptdspviaqalageeikpgphkiqgigagfipgnldl
klidkvvgitneeaistarrlmeeegilagissgaavaaalklqedesftnknivvilps
sgerylstalfadlf
SCOP Domain Coordinates for d1oasb_:
Click to download the PDB-style file with coordinates for d1oasb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1oasb_:
- d1oasb_ appears in SCOP 1.57
- d1oasb_ appears in the current release, SCOPe 2.08
View in 3D
