Lineage for d1fcjd_ (1fcj D:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1006039Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 1006040Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 1006041Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 1006144Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species)
  7. 1006153Species Salmonella typhimurium [TaxId:90371] [53691] (3 PDB entries)
  8. 1006157Domain d1fcjd_: 1fcj D: [35292]
    complexed with cl, plp, so4

Details for d1fcjd_

PDB Entry: 1fcj (more details), 2 Å

PDB Description: crystal structure of oass complexed with chloride and sulfate
PDB Compounds: (D:) O-acetylserine sulfhydrylase

SCOPe Domain Sequences for d1fcjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fcjd_ c.79.1.1 (D:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 90371]}
skiyednsltightplvrlnrigngrilakvesrnpsfsvkcriganmiwdaekrgvlkp
gvelveptngntgialayvaaargykltltmpetmsierrkllkalganlvltegakgmk
gaiqkaeeivasdpqkylllqqfsnpanpeihekttgpeiwedtdgqvdvfisgvgtggt
ltgvtryikgtkgktdlitvaveptdspviaqalageeikpgphkiqgigagfipgnldl
klidkvvgitneeaistarrlmeeegilagissgaavaaalklqedesftnknivvilps
sg

SCOPe Domain Coordinates for d1fcjd_:

Click to download the PDB-style file with coordinates for d1fcjd_.
(The format of our PDB-style files is described here.)

Timeline for d1fcjd_: