Lineage for d6fkfc2 (6fkf C:96-372)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2480841Species Spinacia oleracea [TaxId:3562] [352453] (2 PDB entries)
  8. 2480846Domain d6fkfc2: 6fkf C:96-372 [352478]
    Other proteins in same PDB: d6fkfa1, d6fkfa3, d6fkfb1, d6fkfb2, d6fkfb3, d6fkfc1, d6fkfc3, d6fkfd1, d6fkfd2, d6fkfd3, d6fkfe1, d6fkfe3, d6fkff1, d6fkff2, d6fkff3
    automated match to d1maba3
    complexed with adp, atp, mg

Details for d6fkfc2

PDB Entry: 6fkf (more details), 3.1 Å

PDB Description: chloroplast f1fo conformation 1
PDB Compounds: (C:) ATP synthase subunit alpha, chloroplastic

SCOPe Domain Sequences for d6fkfc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fkfc2 c.37.1.0 (C:96-372) automated matches {Spinacia oleracea [TaxId: 3562]}
aqipvseaylgrvinalakpidgrgeitasesrliespapgimsrrsvyeplqtgliaid
amipvgrgqreliigdrqtgktavatdtilnqqgqnvicvyvaigqkassvaqvvtnfqe
rgameytivvaetadspatlqylapytgaalaeyfmyrerhtliiyddlskqaqayrqms
lllrrppgreaypgdvfylhsrlleraaklssllgegsmtalpivetqagdvsayiptnv
isitdgqiflsadlfnagirpainvgisvsrvgsaaq

SCOPe Domain Coordinates for d6fkfc2:

Click to download the PDB-style file with coordinates for d6fkfc2.
(The format of our PDB-style files is described here.)

Timeline for d6fkfc2: