Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein automated matches [190393] (13 species) not a true protein |
Species Spinacia oleracea [TaxId:3562] [352463] (2 PDB entries) |
Domain d6fkff2: 6fkf F:98-377 [352467] Other proteins in same PDB: d6fkfa1, d6fkfa2, d6fkfa3, d6fkfb1, d6fkfb3, d6fkfc1, d6fkfc2, d6fkfc3, d6fkfd1, d6fkfd3, d6fkfe1, d6fkfe2, d6fkfe3, d6fkff1, d6fkff3 automated match to d2qe7d2 complexed with adp, atp, mg |
PDB Entry: 6fkf (more details), 3.1 Å
SCOPe Domain Sequences for d6fkff2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fkff2 c.37.1.11 (F:98-377) automated matches {Spinacia oleracea [TaxId: 3562]} lsvpvggatlgrifnvlgepvdnlgpvdtrttspihrsapaftqldtklsifetgikvvd llapyrrggkiglfggagvgktvlimelinniakahggvsvfggvgertregndlymemk esgvineqniaeskvalvygqmneppgarmrvgltaltmaeyfrdvneqdvllfidnifr fvqagsevsallgrmpsavgyqptlstemgslqeritstkegsitsiqavyvpaddltdp apattfahldattvlsrglaakgiypavdpldststmlqp
Timeline for d6fkff2: