SCOPe 2.07: Domain d5tw4b1: 5tw4 B:25-315

Lineage for d5tw4b1 (5tw4 B:25-315)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (30 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [352201] (11 PDB entries)

8. Domain d5tw4b1: 5tw4 B:25-315 [352334]
   Other proteins in same PDB: d5tw4a2, d5tw4b2
   automated match to d3huna1
   complexed with ai8, cl, gol, na, zn; mutant

Details for d5tw4b1

PDB Entry: 5tw4, 1.57 Å

PDB Description: crystal structure of s. aureus penicillin binding protein 4 (pbp4) mutant (e183a, f241r) in complex with ceftaroline

PDB Compounds: (B:) Penicillin-binding protein 4

SCOPe Domain Sequences for d5tw4b1:

Sequence; same for both SEQRES and ATOM records:

>d5tw4b1 e.3.1.1 (B:25-315) automated matches {Staphylococcus aureus [TaxId: 93062]}
tnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpasmtklmtmyl
tleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqitvsnssnaaa
lilakkvskntsdfvdlmnnkakaigmknthfvnptgaansrlrtfaptkykdqertvtt
ardyaildlhviketpkildftkqlaptthavtyytrnfslegakmslpgtdglktgssd
tanynhtittkrgkfrinqvimgagdyknlggekqrnmmgnalmersfdqy

Timeline for d5tw4b1:

• d5tw4b1 is new in SCOPe 2.07-stable
  
• d5tw4b1 appears in the current release, SCOPe 2.08