SCOPe 2.07: Domain d5z55a1: 5z55 A:3-85

Lineage for d5z55a1 (5z55 A:3-85)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (3 families)

5. Family g.14.1.0: automated matches [254254] (1 protein)
   not a true family

6. Protein automated matches [254580] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255350] (15 PDB entries)

8. Domain d5z55a1: 5z55 A:3-85 [352306]
   Other proteins in same PDB: d5z55a2
   automated match to d1pk2a_

Details for d5z55a1

PDB Entry: 5z55

PDB Description: nmr solution structure of the kringle domain of human receptor tyrosine kinase-like orphan receptor 1 (ror1)

PDB Compounds: (A:) Inactive tyrosine-protein kinase transmembrane receptor ROR1

SCOPe Domain Sequences for d5z55a1:

Sequence; same for both SEQRES and ATOM records:

>d5z55a1 g.14.1.0 (A:3-85) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kcynstgvdyrgtvsvtksgrqcqpwnsqyphthtftalrfpelngghsycrnpgnqkea
pwcftldenfksdlcdipacdsk

Timeline for d5z55a1:

• d5z55a1 is new in SCOPe 2.07-stable
  
• d5z55a1 appears in the current release, SCOPe 2.08