Lineage for d5z55a1 (5z55 A:3-85)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2584625Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 2584626Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 2584835Family g.14.1.0: automated matches [254254] (1 protein)
    not a true family
  6. 2584836Protein automated matches [254580] (2 species)
    not a true protein
  7. 2584837Species Human (Homo sapiens) [TaxId:9606] [255350] (3 PDB entries)
  8. 3052244Domain d5z55a1: 5z55 A:3-85 [352306]
    Other proteins in same PDB: d5z55a2
    automated match to d1pk2a_

Details for d5z55a1

PDB Entry: 5z55 (more details)

PDB Description: nmr solution structure of the kringle domain of human receptor tyrosine kinase-like orphan receptor 1 (ror1)
PDB Compounds: (A:) Inactive tyrosine-protein kinase transmembrane receptor ROR1

SCOPe Domain Sequences for d5z55a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z55a1 g.14.1.0 (A:3-85) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kcynstgvdyrgtvsvtksgrqcqpwnsqyphthtftalrfpelngghsycrnpgnqkea
pwcftldenfksdlcdipacdsk

SCOPe Domain Coordinates for d5z55a1:

Click to download the PDB-style file with coordinates for d5z55a1.
(The format of our PDB-style files is described here.)

Timeline for d5z55a1:

  • d5z55a1 appears in periodic updates to SCOPe 2.07 starting on 2018-05-17

View in 3D
Domains from same chain:
(mouse over for more information)
d5z55a2