Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) consists of clearly related families of somewhat different folds |
Family c.1.16.0: automated matches [191510] (1 protein) not a true family |
Protein automated matches [190849] (11 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [333823] (3 PDB entries) |
Domain d5xkdc_: 5xkd C: [352003] automated match to d5tlca_ complexed with fmn |
PDB Entry: 5xkd (more details), 2.39 Å
SCOPe Domain Sequences for d5xkdc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xkdc_ c.1.16.0 (C:) automated matches {Bacillus subtilis [TaxId: 1423]} rqlhlagffsagnvthahgawrhvgatngfltgefykqiartlergkfdllflpdglaie dsygdnletgvglggqgavaleptsviatmaavtqrlglgatvsttyyppyhvarvfatl dnlsdgriswnvvtslndsearnfgvdehlehdirydradefleavkklwsswsedalll dkvggrfadpkkvqyvnhrgrwlsvrgplqvprsrqgepvilqaglsprgrrfagrwaea vfsvspnldimravyqdikahvaaagrdpeqtkvftavmpvlgeteqvarerleylnslv hpevglstlsshsglnlskypldtkfsdivadlgdrhvptmlqmfsavagggadltlael grrygtnvgfvpqwagtaeqiadqlishfeagaadgfiispaylpgiyeefvdqvvpllq qrgvfrteyegttlrehlglahpev
Timeline for d5xkdc_: