Lineage for d5xkdd_ (5xkd D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2448077Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) (S)
    consists of clearly related families of somewhat different folds
  5. 2448140Family c.1.16.0: automated matches [191510] (1 protein)
    not a true family
  6. 2448141Protein automated matches [190849] (11 species)
    not a true protein
  7. 2448145Species Bacillus subtilis [TaxId:1423] [333823] (3 PDB entries)
  8. 2448153Domain d5xkdd_: 5xkd D: [351930]
    automated match to d5tlca_
    complexed with fmn

Details for d5xkdd_

PDB Entry: 5xkd (more details), 2.39 Å

PDB Description: crystal structure of dibenzothiophene sulfone monooxygenase bdsa in complex with fmn at 2.4 angstrom
PDB Compounds: (D:) Dibenzothiophene desulfurization enzyme A

SCOPe Domain Sequences for d5xkdd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xkdd_ c.1.16.0 (D:) automated matches {Bacillus subtilis [TaxId: 1423]}
rqlhlagffsagnvthahgawrhvgatngfltgefykqiartlergkfdllflpdglaie
dsygdnletgvglggqgavaleptsviatmaavtqrlglgatvsttyyppyhvarvfatl
dnlsdgriswnvvtslndsearnfgvdehlehdirydradefleavkklwsswsedalll
dkvggrfadpkkvqyvnhrgrwlsvrgplqvprsrqgepvilqaglsprgrrfagrwaea
vfsvspnldimravyqdikahvaaagrdpeqtkvftavmpvlgeteqvarerleylnslv
hpevglstlsshsglnlskypldtkfsdivadlgdrhvptmlqmfsavagggadltlael
grrygtnvgfvpqwagtaeqiadqlishfeagaadgfiispaylpgiyeefvdqvvpllq
qrgvfrteyegttlrehlglahpev

SCOPe Domain Coordinates for d5xkdd_:

Click to download the PDB-style file with coordinates for d5xkdd_.
(The format of our PDB-style files is described here.)

Timeline for d5xkdd_: