Class a: All alpha proteins [46456] (289 folds) |
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) |
Family a.102.1.1: Glucoamylase [48209] (2 proteins) automatically mapped to Pfam PF00723 |
Protein automated matches [191093] (1 species) not a true protein |
Species Aspergillus niger [TaxId:5061] [189072] (2 PDB entries) |
Domain d6frva_: 6frv A: [351861] automated match to d3glya_ complexed with man, nag |
PDB Entry: 6frv (more details), 2.3 Å
SCOPe Domain Sequences for d6frva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6frva_ a.102.1.1 (A:) automated matches {Aspergillus niger [TaxId: 5061]} atldswlsneatvartailnnigadgawvsgadsgivvaspstdnpdyfytwtrdsglvl ktlvdlfrngdtsllstienyisaqaivqgisnpsgdlssgaglgepkfnvdetaytgsw grpqrdgpalratamigfgqwlldngytstatdivwplvrndlsyvaqywnqtgydlwee vngssfftiavqhralvegsafatavgsscswcdsqapeilcylqsfwtgsfilanfdss rsgkdantllgsihtfdpeaacddstfqpcspralanhkevvdsfrsiytlndglsdsea vavgrypedtyyngnpwflctlaaaeqlydalyqwdkqgslevtdvsldffkalysdaat gtyssssstyssivdavktfadgfvsivethaasngsmseqydksdgeqlsardltwsya alltannrrnsvvpaswgetsassvpgtcaatsaigtyssvtvtswp
Timeline for d6frva_: