Lineage for d6frva_ (6frv A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330024Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2330025Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2330026Family a.102.1.1: Glucoamylase [48209] (2 proteins)
    automatically mapped to Pfam PF00723
  6. 2330039Protein automated matches [191093] (1 species)
    not a true protein
  7. 2330040Species Aspergillus niger [TaxId:5061] [189072] (2 PDB entries)
  8. 3051799Domain d6frva_: 6frv A: [351861]
    automated match to d3glya_
    complexed with man, nag

Details for d6frva_

PDB Entry: 6frv (more details), 2.3 Å

PDB Description: structure of the catalytic domain of aspergillus niger glucoamylase
PDB Compounds: (A:) glucoamylase

SCOPe Domain Sequences for d6frva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6frva_ a.102.1.1 (A:) automated matches {Aspergillus niger [TaxId: 5061]}
atldswlsneatvartailnnigadgawvsgadsgivvaspstdnpdyfytwtrdsglvl
ktlvdlfrngdtsllstienyisaqaivqgisnpsgdlssgaglgepkfnvdetaytgsw
grpqrdgpalratamigfgqwlldngytstatdivwplvrndlsyvaqywnqtgydlwee
vngssfftiavqhralvegsafatavgsscswcdsqapeilcylqsfwtgsfilanfdss
rsgkdantllgsihtfdpeaacddstfqpcspralanhkevvdsfrsiytlndglsdsea
vavgrypedtyyngnpwflctlaaaeqlydalyqwdkqgslevtdvsldffkalysdaat
gtyssssstyssivdavktfadgfvsivethaasngsmseqydksdgeqlsardltwsya
alltannrrnsvvpaswgetsassvpgtcaatsaigtyssvtvtswp

SCOPe Domain Coordinates for d6frva_:

Click to download the PDB-style file with coordinates for d6frva_.
(The format of our PDB-style files is described here.)

Timeline for d6frva_:

  • d6frva_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-09