SCOPe 2.07: Domain d5xj4h_: 5xj4 H:

Lineage for d5xj4h_ (5xj4 H:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)

8. Domain d5xj4h_: 5xj4 H: [351515]
   Other proteins in same PDB: d5xj4l_
   automated match to d4y5vg_

Details for d5xj4h_

PDB Entry: 5xj4, 2.3 Å

PDB Description: complex structure of durvalumab-scfv/pd-l1

PDB Compounds: (H:) durvalumab-VH

SCOPe Domain Sequences for d5xj4h_:

Sequence; same for both SEQRES and ATOM records:

>d5xj4h_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgftfsrywmswvrqapgkglewvanikqdgsekyy
vdsvkgrftisrdnaknslylqmnslraedtavyycareggwfgelafdywgqgtlvtvs

Timeline for d5xj4h_:

• d5xj4h_ is new in SCOPe 2.07-stable
  
• d5xj4h_ appears in the current release, SCOPe 2.08