Lineage for d5xj4h_ (5xj4 H:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (21 species)
    not a true protein
  7. 2347244Species Human (Homo sapiens) [TaxId:9606] [188740] (223 PDB entries)
  8. 3051453Domain d5xj4h_: 5xj4 H: [351515]
    Other proteins in same PDB: d5xj4l_
    automated match to d4y5vg_

Details for d5xj4h_

PDB Entry: 5xj4 (more details), 2.3 Å

PDB Description: complex structure of durvalumab-scfv/pd-l1
PDB Compounds: (H:) durvalumab-VH

SCOPe Domain Sequences for d5xj4h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xj4h_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgftfsrywmswvrqapgkglewvanikqdgsekyy
vdsvkgrftisrdnaknslylqmnslraedtavyycareggwfgelafdywgqgtlvtvs

SCOPe Domain Coordinates for d5xj4h_:

Click to download the PDB-style file with coordinates for d5xj4h_.
(The format of our PDB-style files is described here.)

Timeline for d5xj4h_:

  • d5xj4h_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-26

View in 3D
Domains from other chains:
(mouse over for more information)
d5xj4l_