Class b: All beta proteins [48724] (178 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
Protein automated matches [226946] (29 species) not a true protein |
Species Thermotoga neapolitana [TaxId:309803] [351492] (1 PDB entry) |
Domain d5w75b2: 5w75 B:203-301 [351509] Other proteins in same PDB: d5w75a1, d5w75a3, d5w75a4, d5w75b1, d5w75b3, d5w75b4, d5w75c1, d5w75c3, d5w75c4, d5w75d1, d5w75d3, d5w75d4 automated match to d1b23p1 complexed with gdp, mg, so4, suc |
PDB Entry: 5w75 (more details), 2.3 Å
SCOPe Domain Sequences for d5w75b2:
Sequence, based on SEQRES records: (download)
>d5w75b2 b.43.3.0 (B:203-301) automated matches {Thermotoga neapolitana [TaxId: 309803]} pqrdvdkpflmpiedvfsitgrgtvvtgriergrirpgdeveiiglsyeirktvvtsvem frkeldegiagdnvgcllrgidkdevergqvlaapgsikp
>d5w75b2 b.43.3.0 (B:203-301) automated matches {Thermotoga neapolitana [TaxId: 309803]} pqrdvdkpflmpiedvfsitgrgtvvtgriergrirpgdeveiiglseirktvvtsvemf rkeldegiagdnvgcllrgidkdevergqvlaapgsikp
Timeline for d5w75b2: