SCOPe 2.08: Domain d6b1uf2: 6b1u F:183-324

Lineage for d6b1uf2 (6b1u F:183-324)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein 5'-AMP-activated protein kinase subunit gamma-1, AMPKg [160176] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [160177] (15 PDB entries)
   Uniprot P80385 182-326! Uniprot P80385 23-181

8. Domain d6b1uf2: 6b1u F:183-324 [351413]
   automated match to d2v8qe1
   complexed with amp, cg7, imd, stu

Details for d6b1uf2

PDB Entry: 6b1u, 2.77 Å

PDB Description: structure of full-length human ampk (a2b1g1) in complex with a small molecule activator sc4

PDB Compounds: (F:) 5'-amp-activated protein kinase subunit gamma-1

SCOPe Domain Sequences for d6b1uf2:

Sequence; same for both SEQRES and ATOM records:

>d6b1uf2 d.37.1.1 (F:183-324) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Norway rat (Rattus norvegicus) [TaxId: 10116]}
fpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdiys
kfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetletiinrlveaevhrlvv
vdendvvkgivslsdilqalvl

Timeline for d6b1uf2:

• d6b1uf2 first appeared in SCOPe 2.07