Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
Protein automated matches [226837] (9 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226564] (136 PDB entries) |
Domain d6fkjd1: 6fkj D:2-245 [350774] Other proteins in same PDB: d6fkja2, d6fkjb2, d6fkjc2, d6fkjd2, d6fkje_, d6fkjf1, d6fkjf2, d6fkjf3 automated match to d4drxb1 complexed with acp, ca, dlw, gdp, gol, gtp, mes, mg, pg4 |
PDB Entry: 6fkj (more details), 2.15 Å
SCOPe Domain Sequences for d6fkjd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fkjd1 c.32.1.1 (D:2-245) automated matches {Cow (Bos taurus) [TaxId: 9913]} reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr fp
Timeline for d6fkjd1: