SCOPe 2.08: Domain d6ckpa1: 6ckp A:1-107

Lineage for d6ckpa1 (6ckp A:1-107)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Brucella melitensis [TaxId:29459] [255346] (2 PDB entries)

8. Domain d6ckpa1: 6ckp A:1-107 [350179]
   Other proteins in same PDB: d6ckpa2
   automated match to d2h74a_

Details for d6ckpa1

PDB Entry: 6ckp, 1.15 Å

PDB Description: crystal structure of a thioredoxin domain 2 from brucella melitensis at 1.15 angstrom resolution

PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d6ckpa1:

Sequence; same for both SEQRES and ATOM records:

>d6ckpa1 c.47.1.0 (A:1-107) automated matches {Brucella melitensis [TaxId: 29459]}
matvkvdnsnfqsdvlqssepvvvdfwaewcgpcktiapaldeiaaemagqvkiakvnid
enpelaaqfgvrsiptllmfkdgelaanmvgaapksrladwikasaa

Timeline for d6ckpa1:

• d6ckpa1 first appeared in SCOPe 2.07