Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Brucella melitensis [TaxId:29459] [255346] (2 PDB entries) |
Domain d6ckpa1: 6ckp A:1-107 [350179] Other proteins in same PDB: d6ckpa2 automated match to d2h74a_ |
PDB Entry: 6ckp (more details), 1.15 Å
SCOPe Domain Sequences for d6ckpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ckpa1 c.47.1.0 (A:1-107) automated matches {Brucella melitensis [TaxId: 29459]} matvkvdnsnfqsdvlqssepvvvdfwaewcgpcktiapaldeiaaemagqvkiakvnid enpelaaqfgvrsiptllmfkdgelaanmvgaapksrladwikasaa
Timeline for d6ckpa1: