Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (50 species) not a true protein |
Species Cryptosporidium parvum [TaxId:353152] [326193] (5 PDB entries) |
Domain d6c86b1: 6c86 B:46-189 [350167] Other proteins in same PDB: d6c86a2, d6c86a3, d6c86b2, d6c86b3 automated match to d5elna1 protein/RNA complex; complexed with cl, edo, kaa, na, so4 |
PDB Entry: 6c86 (more details), 2.15 Å
SCOPe Domain Sequences for d6c86b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6c86b1 b.40.4.0 (B:46-189) automated matches {Cryptosporidium parvum [TaxId: 353152]} hytdnrykmmecikdagrpfyphkfkismslpayalkygnvengyidkdttlslsgrvts irssssklifydifceeqkvqiianimehdistgefsvshseirrgdvvgftgfpgkskr gelslfsksvvllspcyhmlptai
Timeline for d6c86b1: