Lineage for d6c86a1 (6c86 A:46-193)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2400006Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2400007Protein automated matches [190576] (50 species)
    not a true protein
  7. 2400065Species Cryptosporidium parvum [TaxId:353152] [326193] (5 PDB entries)
  8. 2400078Domain d6c86a1: 6c86 A:46-193 [350127]
    Other proteins in same PDB: d6c86a2, d6c86a3, d6c86b2, d6c86b3
    automated match to d5elna1
    protein/RNA complex; complexed with cl, edo, kaa, na, so4

Details for d6c86a1

PDB Entry: 6c86 (more details), 2.15 Å

PDB Description: crystal structure of lysyl-trna synthetase from cryptosporidium parvum complexed with l-lysylsulfamoyl adenosine
PDB Compounds: (A:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6c86a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c86a1 b.40.4.0 (A:46-193) automated matches {Cryptosporidium parvum [TaxId: 353152]}
hytdnrykmmecikdagrpfyphkfkismslpayalkygnvengyidkdttlslsgrvts
irssssklifydifceeqkvqiianimehdistgefsvshseirrgdvvgftgfpgkskr
gelslfsksvvllspcyhmlptaisglk

SCOPe Domain Coordinates for d6c86a1:

Click to download the PDB-style file with coordinates for d6c86a1.
(The format of our PDB-style files is described here.)

Timeline for d6c86a1: