SCOPe 2.08: Domain d6bq3a_: 6bq3 A:

Lineage for d6bq3a_ (6bq3 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (87 species)
   not a true protein

7. Species Medicago truncatula [TaxId:3880] [225108] (10 PDB entries)

8. Domain d6bq3a_: 6bq3 A: [349779]
   automated match to d3o4fc_
   complexed with dsh

Details for d6bq3a_

PDB Entry: 6bq3, 1.91 Å

PDB Description: crystal structure of medicago truncatula thermospermine synthase (mttsps) in complex with 5'-s-(3-aminopropyl)-5'-thioadenosine

PDB Compounds: (A:) Thermospermine synthase

SCOPe Domain Sequences for d6bq3a_:

Sequence; same for both SEQRES and ATOM records:

>d6bq3a_ c.66.1.0 (A:) automated matches {Medicago truncatula [TaxId: 3880]}
kscwyeeeieenlrwcfalnsilhtgasqyqdialldtkpfgkalvldgklqsaetdefi
yheclvhpallhhpmpknvfimgggegstarellrhktidkvvmcdideevvefcksylv
vnkeafhdsrlevvindakaelegkeekydvivgdladpieggpcyklytkdfyeltlkp
klkkggifvtqagpagifshtevfsciyntlrqvfkyvvpysahipsyadiwgwvlasds
pldlsaeeldirmrqriieenryldgktfvssstlskavrnslnnethvyte

Timeline for d6bq3a_:

• d6bq3a_ first appeared in SCOPe 2.07