Lineage for d6avyb_ (6avy B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509433Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2509434Protein automated matches [190543] (124 species)
    not a true protein
  7. 2510772Species Zea mays [TaxId:4577] [349272] (1 PDB entry)
  8. 2510774Domain d6avyb_: 6avy B: [349273]
    automated match to d5krea_

Details for d6avyb_

PDB Entry: 6avy (more details), 2.24 Å

PDB Description: crystal structure of zea mays acyl-protein thioesterase 2
PDB Compounds: (B:) Acyl-protein thioesterase 2

SCOPe Domain Sequences for d6avyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6avyb_ c.69.1.0 (B:) automated matches {Zea mays [TaxId: 4577]}
eygrthvvrpkgthkativwlhglgdngtswsqlletlplpnikwicptapsrpvslfgg
fpctawfdvadlsedapddtegmdasaahvanllstepadiklgvggfsmgaatalysat
cfahgkygngnpypvnlslavglsgwlpcartlknrieaspeaaqrastiplllchgkad
dvvlykhgqrstdalkangfsnvlfksynslghytvpeemdevckwltanlg

SCOPe Domain Coordinates for d6avyb_:

Click to download the PDB-style file with coordinates for d6avyb_.
(The format of our PDB-style files is described here.)

Timeline for d6avyb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6avya_