SCOPe 2.08: Domain d6avyb_: 6avy B:

Lineage for d6avyb_ (6avy B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Maize (Zea mays) [TaxId:4577] [349272] (1 PDB entry)

8. Domain d6avyb_: 6avy B: [349273]
   automated match to d5krea_

Details for d6avyb_

PDB Entry: 6avy, 2.24 Å

PDB Description: crystal structure of zea mays acyl-protein thioesterase 2

PDB Compounds: (B:) Acyl-protein thioesterase 2

SCOPe Domain Sequences for d6avyb_:

Sequence; same for both SEQRES and ATOM records:

>d6avyb_ c.69.1.0 (B:) automated matches {Maize (Zea mays) [TaxId: 4577]}
eygrthvvrpkgthkativwlhglgdngtswsqlletlplpnikwicptapsrpvslfgg
fpctawfdvadlsedapddtegmdasaahvanllstepadiklgvggfsmgaatalysat
cfahgkygngnpypvnlslavglsgwlpcartlknrieaspeaaqrastiplllchgkad
dvvlykhgqrstdalkangfsnvlfksynslghytvpeemdevckwltanlg

Timeline for d6avyb_:

• d6avyb_ first appeared in SCOPe 2.07