Lineage for d6dfra_ (6dfr A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1618271Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1618272Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1618273Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 1618302Protein Dihydrofolate reductase, prokaryotic type [53599] (8 species)
  7. 1618316Species Escherichia coli [TaxId:562] [53600] (70 PDB entries)
  8. 1618400Domain d6dfra_: 6dfr A: [34874]
    complexed with ca, nap

Details for d6dfra_

PDB Entry: 6dfr (more details), 2.4 Å

PDB Description: crystal structures of escherichia coli dihydrofolate reductase. the nadp+ holoenzyme and the folate(dot)nadp+ ternary complex. substrate binding and a model for the transition state
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d6dfra_:

Sequence, based on SEQRES records: (download)

>d6dfra_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]}
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr

Sequence, based on observed residues (ATOM records): (download)

>d6dfra_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]}
misliaalavdrvigpwnlpadlawfkrntldkpvimgrhtwesigrplpgrkniilssq
pgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaevegdthf
pdyepddwesvfsefhdadaqnshsycfeilerr

SCOPe Domain Coordinates for d6dfra_:

Click to download the PDB-style file with coordinates for d6dfra_.
(The format of our PDB-style files is described here.)

Timeline for d6dfra_: