Lineage for d6dfr__ (6dfr -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26980Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)
  4. 26981Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) (S)
  5. 26982Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)
  6. 26986Protein Dihydrofolate reductase, prokaryotic type [53599] (5 species)
  7. 26987Species Escherichia coli [TaxId:562] [53600] (42 PDB entries)
  8. 27042Domain d6dfr__: 6dfr - [34874]

Details for d6dfr__

PDB Entry: 6dfr (more details), 2.4 Å

PDB Description: crystal structures of escherichia coli dihydrofolate reductase. the nadp+ holoenzyme and the folate(dot)nadp+ ternary complex. substrate binding and a model for the transition state

SCOP Domain Sequences for d6dfr__:

Sequence, based on SEQRES records: (download)

>d6dfr__ c.71.1.1 (-) Dihydrofolate reductase, prokaryotic type {Escherichia coli}
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr

Sequence, based on observed residues (ATOM records): (download)

>d6dfr__ c.71.1.1 (-) Dihydrofolate reductase, prokaryotic type {Escherichia coli}
misliaalavdrvigpwnlpadlawfkrntldkpvimgrhtwesigrplpgrkniilssq
pgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaevegdthf
pdyepddwesvfsefhdadaqnshsycfeilerr

SCOP Domain Coordinates for d6dfr__:

Click to download the PDB-style file with coordinates for d6dfr__.
(The format of our PDB-style files is described here.)

Timeline for d6dfr__: