Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
Protein Dihydrofolate reductase, prokaryotic type [53599] (8 species) |
Species Escherichia coli [TaxId:562] [53600] (74 PDB entries) |
Domain d1rx8a_: 1rx8 A: [34873] complexed with bme, fol, mn, nap |
PDB Entry: 1rx8 (more details), 2.8 Å
SCOPe Domain Sequences for d1rx8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rx8a_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]} misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve gdthfpdyepddwesvfsefhdadaqnshsycfeilerr
Timeline for d1rx8a_: