SCOPe 2.04: Domain d1rb2b_: 1rb2 B:

Lineage for d1rb2b_ (1rb2 B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (8 species)

7. Species Escherichia coli [TaxId:562] [53600] (70 PDB entries)

8. Domain d1rb2b_: 1rb2 B: [34864]
   complexed with fol, nap

Details for d1rb2b_

PDB Entry: 1rb2, 2.1 Å

PDB Description: dihydrofolate reductase complexed with folate and nicotinamide adenine dinucleotide phosphate (oxidized form)

PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d1rb2b_:

Sequence; same for both SEQRES and ATOM records:

>d1rb2b_ c.71.1.1 (B:) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]}
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr

Timeline for d1rb2b_:

• d1rb2b_ first appeared (with stable ids) in SCOP 1.55
  
• d1rb2b_ appears in SCOPe 2.03
  
• d1rb2b_ appears in SCOPe 2.05
  
• d1rb2b_ appears in the current release, SCOPe 2.08