Lineage for d1rb2b_ (1rb2 B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.71: Dihydrofolate reductases [53596] (1 superfamily) Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) 
Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins) Protein Dihydrofolate reductase, prokaryotic type [53599] (5 species) Species Escherichia coli [TaxId:562] [53600] (42 PDB entries) 
Domain d1rb2b_: 1rb2 B: [34864]
Details for d1rb2b_
PDB Entry: 1rb2 (more details), 2.1 Å
PDB Description: dihydrofolate reductase complexed with folate and nicotinamide adenine dinucleotide phosphate (oxidized form)
SCOP Domain Sequences for d1rb2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rb2b_ c.71.1.1 (B:) Dihydrofolate reductase, prokaryotic type {Escherichia coli}
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr
SCOP Domain Coordinates for d1rb2b_:
Click to download the PDB-style file with coordinates for d1rb2b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rb2b_:
- d1rb2b_ appears in SCOP 1.57
- d1rb2b_ appears in the current release, SCOPe 2.08
View in 3D
