SCOPe 2.05: Domain d1joma_: 1jom A:

Lineage for d1joma_ (1jom A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (8 species)

7. Species Escherichia coli [TaxId:562] [53600] (74 PDB entries)

8. Domain d1joma_: 1jom A: [34839]
   complexed with ca, cl, eoh, ffo

Details for d1joma_

PDB Entry: 1jom, 1.9 Å

PDB Description: the crystal structure of the binary complex between folinic acid (leucovorin) and e. coli dihydrofolate reductase

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d1joma_:

Sequence; same for both SEQRES and ATOM records:

>d1joma_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]}
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr

Timeline for d1joma_:

• d1joma_ first appeared (with stable ids) in SCOP 1.55, called d1jom__
  
• d1joma_ appears in SCOPe 2.04
  
• d1joma_ appears in SCOPe 2.06
  
• d1joma_ appears in the current release, SCOPe 2.08