Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
Protein Lactate dehydrogenase [56339] (20 species) |
Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [64445] (39 PDB entries) |
Domain d5w8lb2: 5w8l B:160-331 [348101] Other proteins in same PDB: d5w8la1, d5w8lb1, d5w8lc1, d5w8ld1 automated match to d4jnka2 complexed with 9ya, edo, nai |
PDB Entry: 5w8l (more details), 1.95 Å
SCOPe Domain Sequences for d5w8lb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5w8lb2 d.162.1.1 (B:160-331) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]} sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgt dkdkeqwkevhkqvvesayeviklkgytswaiglsvadlaesimknlrrvhpvstmikgl ygikddvflsvpcilgqngisdlvkvtltseeearlkksadtlwgiqkelqf
Timeline for d5w8lb2: