Lineage for d1dwqb_ (1dwq B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1002544Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1002545Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1003485Family c.69.1.20: Hydroxynitrile lyase-like [53585] (3 proteins)
  6. 1003486Protein Hydroxynitrile lyase [53586] (2 species)
  7. 1003487Species Cassava (Manihot esculenta) [TaxId:3983] [53588] (7 PDB entries)
  8. 1003501Domain d1dwqb_: 1dwq B: [34809]
    complexed with ato

Details for d1dwqb_

PDB Entry: 1dwq (more details), 2.2 Å

PDB Description: crystal structure of hydroxynitrile lyase from manihot esculenta in complex with substrates acetone and chloroacetone:implications for the mechanism of cyanogenesis
PDB Compounds: (B:) hydroxynitrile lyase

SCOPe Domain Sequences for d1dwqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dwqb_ c.69.1.20 (B:) Hydroxynitrile lyase {Cassava (Manihot esculenta) [TaxId: 3983]}
mvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfdeysep
lltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsytvek
llesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrkgslf
qnvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdhklql
tkteevahilqevadaya

SCOPe Domain Coordinates for d1dwqb_:

Click to download the PDB-style file with coordinates for d1dwqb_.
(The format of our PDB-style files is described here.)

Timeline for d1dwqb_: