SCOPe 2.08: Domain d5wddb_: 5wdd B:

Lineage for d5wddb_ (5wdd B:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.0: automated matches [195065] (1 protein)
   not a true family

6. Protein automated matches [195066] (5 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [348036] (1 PDB entry)

8. Domain d5wddb_: 5wdd B: [348037]
   automated match to d2imsa_
   complexed with edo

Details for d5wddb_

PDB Entry: 5wdd, 1.8 Å

PDB Description: crystal structure of chicken bok

PDB Compounds: (B:) Bcl-2-related ovarian killer protein

SCOPe Domain Sequences for d5wddb_:

Sequence; same for both SEQRES and ATOM records:

>d5wddb_ f.1.4.0 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
ptdkelvsqakalcrdyinsrliragvswskpehntpvpggklaevsaillrlgdeleyi
rpnvyrniarqlnislhsetvvtdaflavaaqiftagitwgkvvslyavaaglavdcvrh
aqpamvhtivdclgefvrktlvtwlkrrggwaditkcvv

Timeline for d5wddb_:

• d5wddb_ first appeared in SCOPe 2.07