Lineage for d4yasa_ (4yas A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1002544Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1002545Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1003485Family c.69.1.20: Hydroxynitrile lyase-like [53585] (3 proteins)
  6. 1003486Protein Hydroxynitrile lyase [53586] (2 species)
  7. 1003502Species Rubber tree (Hevea brasiliensis) [TaxId:3981] [53587] (19 PDB entries)
    Uniprot P52704
  8. 1003516Domain d4yasa_: 4yas A: [34800]
    complexed with clx, so4

Details for d4yasa_

PDB Entry: 4yas (more details), 2 Å

PDB Description: hydroxynitrile lyase complexed with chloralhydrate
PDB Compounds: (A:) protein (hydroxynitrile lyase)

SCOPe Domain Sequences for d4yasa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yasa_ c.69.1.20 (A:) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]}
afahfvlihtichgawiwhklkpllealghkvtaldlaasgvdprqieeigsfdeysepl
ltflealppgekvilvgescgglniaiaadkycekiaaavfhnsvlpdtehcpsyvvdkl
mevfpdwkdttyftytkdgkeitglklgftllrenlytlcgpeeyelakmltrkgslfqn
ilakrpfftkegygsikkiyvwtdqdeiflpefqlwqienykpdkvykveggdhklqltk
tkeiaeilqevadtyn

SCOPe Domain Coordinates for d4yasa_:

Click to download the PDB-style file with coordinates for d4yasa_.
(The format of our PDB-style files is described here.)

Timeline for d4yasa_: