SCOPe 2.08: Domain d5ovja_: 5ovj A:

Lineage for d5ovja_ (5ovj A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [189539] (12 PDB entries)

8. Domain d5ovja_: 5ovj A: [347674]
   automated match to d3gdfa_
   complexed with so4

Details for d5ovja_

PDB Entry: 5ovj, 1.7 Å

PDB Description: structure of the apo form of mycobacterium smegmatis maba

PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] reductase FabG

SCOPe Domain Sequences for d5ovja_:

Sequence; same for both SEQRES and ATOM records:

>d5ovja_ c.2.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
grpafvsrsvlvtggnrgiglaiarrlaadghkvavthrgsgapddlfgvqcdvtdsaav
drafkeveehqgpvevlvanagiskdaflmrmteerfeevintnltgafrcaqrasrtmq
rkrfgriifigsvsgmwgignqanyaaakagligmarsisrelakagvtanvvapgyidt
emtralderiqagaldfipakrvgtaeevagavsflasedasyiagavipvdggmgmgh

Timeline for d5ovja_:

• d5ovja_ first appeared in SCOPe 2.07