SCOPe 2.07: Domain d5onua1: 5onu A:32-350

Lineage for d5onua1 (5onu A:32-350)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)

4. Superfamily f.4.3: Porins [56935] (5 families)

5. Family f.4.3.0: automated matches [267625] (1 protein)
   not a true family

6. Protein automated matches [267676] (11 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [347328] (1 PDB entry)

8. Domain d5onua1: 5onu A:32-350 [347350]
   Other proteins in same PDB: d5onua2, d5onub2, d5onuc2
   automated match to d4d65a_
   complexed with c8e, gol, lda

Details for d5onua1

PDB Entry: 5onu, 2.22 Å

PDB Description: trimeric ompu structure

PDB Compounds: (A:) Outer membrane protein OmpU

SCOPe Domain Sequences for d5onua1:

Sequence; same for both SEQRES and ATOM records:

>d5onua1 f.4.3.0 (A:32-350) automated matches {Vibrio cholerae [TaxId: 666]}
ginqsgdkagstvysakgtslevggraearlslkdgkaqdnsrvrlnflgkaeindslyg
vgfyegefttndqgknasnnsldnrytyagiggtygevtygkndgalgvitdftdimsyh
gntaaekiavadrvdnmlaykgqfgdlgvkasyrfadrnavdamgnvvtetnaakysdng
edgyslsaiytfgdtgfnvgagyadqddqneymlaasyrmenlyfaglftdgelakdvdy
tgyelaagyklgqaaftatynnaetaketsadnfaidatyyfkpnfrsyisyqfnlldsd
kvgkvasedelaiglrydf

Timeline for d5onua1:

• d5onua1 is new in SCOPe 2.07-stable
  
• d5onua1 appears in the current release, SCOPe 2.08