Lineage for d5o22d2 (5o22 D:123-285)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2453552Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 2453840Protein automated matches [227005] (6 species)
    not a true protein
  7. 2453878Species Escherichia coli [TaxId:83333] [346973] (3 PDB entries)
  8. 2453890Domain d5o22d2: 5o22 D:123-285 [347009]
    Other proteins in same PDB: d5o22a1, d5o22b1, d5o22b3, d5o22c1, d5o22d1, d5o22d3
    automated match to d1b0aa1
    complexed with c3r

Details for d5o22d2

PDB Entry: 5o22 (more details), 2.1 Å

PDB Description: e. coli fold in complex with carolacton
PDB Compounds: (D:) Bifunctional protein folD

SCOPe Domain Sequences for d5o22d2:

Sequence, based on SEQRES records: (download)

>d5o22d2 c.2.1.7 (D:123-285) automated matches {Escherichia coli [TaxId: 83333]}
fhpynvgrlcqraprlrpctprgivtllerynidtfglnavvigasnivgrpmsmellla
gctttvthrftknlrhhvenadllivavgkpgfipgdwikegaividvginrlengkvvg
dvvfedaakrasyitpvpggvgpmtvatlientlqacveyhdp

Sequence, based on observed residues (ATOM records): (download)

>d5o22d2 c.2.1.7 (D:123-285) automated matches {Escherichia coli [TaxId: 83333]}
fhpynvgrlcqraprlrpctprgivtllerynidtfglnavvigasnivgrpmsmellla
gctttvthrftknlrhhvenadllivavgkpgfipgdwikegaividvginrvvgdvvfe
daakrasyitpvpggvgpmtvatlientlqacveyhdp

SCOPe Domain Coordinates for d5o22d2:

Click to download the PDB-style file with coordinates for d5o22d2.
(The format of our PDB-style files is described here.)

Timeline for d5o22d2: