SCOPe 2.08: Domain d5o22d2: 5o22 D:123-285

Lineage for d5o22d2 (5o22 D:123-285)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein automated matches [227005] (6 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [346973] (3 PDB entries)

8. Domain d5o22d2: 5o22 D:123-285 [347009]
   Other proteins in same PDB: d5o22a1, d5o22b1, d5o22b3, d5o22c1, d5o22d1, d5o22d3
   automated match to d1b0aa1
   complexed with c3r

Details for d5o22d2

PDB Entry: 5o22, 2.1 Å

PDB Description: e. coli fold in complex with carolacton

PDB Compounds: (D:) Bifunctional protein folD

SCOPe Domain Sequences for d5o22d2:

Sequence, based on SEQRES records:

>d5o22d2 c.2.1.7 (D:123-285) automated matches {Escherichia coli [TaxId: 83333]}
fhpynvgrlcqraprlrpctprgivtllerynidtfglnavvigasnivgrpmsmellla
gctttvthrftknlrhhvenadllivavgkpgfipgdwikegaividvginrlengkvvg
dvvfedaakrasyitpvpggvgpmtvatlientlqacveyhdp

Sequence, based on observed residues (ATOM records):

>d5o22d2 c.2.1.7 (D:123-285) automated matches {Escherichia coli [TaxId: 83333]}
fhpynvgrlcqraprlrpctprgivtllerynidtfglnavvigasnivgrpmsmellla
gctttvthrftknlrhhvenadllivavgkpgfipgdwikegaividvginrvvgdvvfe
daakrasyitpvpggvgpmtvatlientlqacveyhdp

Timeline for d5o22d2:

• d5o22d2 first appeared in SCOPe 2.07