Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
Protein automated matches [227005] (6 species) not a true protein |
Species Escherichia coli [TaxId:83333] [346973] (3 PDB entries) |
Domain d5o22d2: 5o22 D:123-285 [347009] Other proteins in same PDB: d5o22a1, d5o22b1, d5o22b3, d5o22c1, d5o22d1, d5o22d3 automated match to d1b0aa1 complexed with c3r |
PDB Entry: 5o22 (more details), 2.1 Å
SCOPe Domain Sequences for d5o22d2:
Sequence, based on SEQRES records: (download)
>d5o22d2 c.2.1.7 (D:123-285) automated matches {Escherichia coli [TaxId: 83333]} fhpynvgrlcqraprlrpctprgivtllerynidtfglnavvigasnivgrpmsmellla gctttvthrftknlrhhvenadllivavgkpgfipgdwikegaividvginrlengkvvg dvvfedaakrasyitpvpggvgpmtvatlientlqacveyhdp
>d5o22d2 c.2.1.7 (D:123-285) automated matches {Escherichia coli [TaxId: 83333]} fhpynvgrlcqraprlrpctprgivtllerynidtfglnavvigasnivgrpmsmellla gctttvthrftknlrhhvenadllivavgkpgfipgdwikegaividvginrvvgdvvfe daakrasyitpvpggvgpmtvatlientlqacveyhdp
Timeline for d5o22d2: