Class a: All alpha proteins [46456] (289 folds) |
Fold a.289: Sec63 N-terminal domain-like [158701] (1 superfamily) multihelical; consists of two helical subdomains |
Superfamily a.289.1: Sec63 N-terminal domain-like [158702] (4 families) |
Family a.289.1.3: Helicase "ratchet" domain [345959] (1 protein) Pfam PF04408; follows the extended AAA-ATPase and winged-helix domains |
Protein Pre-mRNA splicing factor DEAH RNA helicase Prp43 [346045] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346216] (2 PDB entries) |
Domain d5jpta4: 5jpt A:521-634 [345698] Other proteins in same PDB: d5jpta1, d5jpta2, d5jpta3, d5jpta5, d5jptb1, d5jptb2, d5jptb3, d5jptb5 automated match to d3kx2a4 protein/RNA complex; complexed with act, cdp, gol, mg, ni |
PDB Entry: 5jpt (more details), 2.94 Å
SCOPe Domain Sequences for d5jpta4:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jpta4 a.289.1.3 (A:521-634) Pre-mRNA splicing factor DEAH RNA helicase Prp43 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} pldpmlavmligsfefqcsqeiltivamlsvpnvfirptkdkkraddaknifahpdgdhi tllnvyhafksdeayeygihkwcrdhylnyrslsaadnirsqlerlmnrynlel
Timeline for d5jpta4: