Lineage for d5jpta4 (5jpt A:521-634)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2352196Fold a.289: Sec63 N-terminal domain-like [158701] (1 superfamily)
    multihelical; consists of two helical subdomains
  4. 2352197Superfamily a.289.1: Sec63 N-terminal domain-like [158702] (4 families) (S)
  5. 2352206Family a.289.1.3: Helicase "ratchet" domain [345959] (1 protein)
    Pfam PF04408; follows the extended AAA-ATPase and winged-helix domains
  6. 2352207Protein Pre-mRNA splicing factor DEAH RNA helicase Prp43 [346045] (1 species)
  7. 2352208Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346216] (2 PDB entries)
  8. 2352211Domain d5jpta4: 5jpt A:521-634 [345698]
    Other proteins in same PDB: d5jpta1, d5jpta2, d5jpta3, d5jpta5, d5jptb1, d5jptb2, d5jptb3, d5jptb5
    automated match to d3kx2a4
    protein/RNA complex; complexed with act, cdp, gol, mg, ni

Details for d5jpta4

PDB Entry: 5jpt (more details), 2.94 Å

PDB Description: crystal structure of the prp43p deah-box rna helicase in complex with cdp
PDB Compounds: (A:) Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43

SCOPe Domain Sequences for d5jpta4:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jpta4 a.289.1.3 (A:521-634) Pre-mRNA splicing factor DEAH RNA helicase Prp43 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
pldpmlavmligsfefqcsqeiltivamlsvpnvfirptkdkkraddaknifahpdgdhi
tllnvyhafksdeayeygihkwcrdhylnyrslsaadnirsqlerlmnrynlel

SCOPe Domain Coordinates for d5jpta4:

Click to download the PDB-style file with coordinates for d5jpta4.
(The format of our PDB-style files is described here.)

Timeline for d5jpta4: