SCOPe 2.07: Domain d5elga2: 5elg A:86-213

Lineage for d5elga2 (5elg A:86-213)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (71 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [324612] (22 PDB entries)

8. Domain d5elga2: 5elg A:86-213 [345609]
   Other proteins in same PDB: d5elga1
   automated match to d5evoa2
   complexed with gol, gsh

Details for d5elga2

PDB Entry: 5elg, 1.81 Å

PDB Description: the structure of dhar1 from arabidopsis thaliana

PDB Compounds: (A:) Glutathione S-transferase DHAR1, mitochondrial

SCOPe Domain Sequences for d5elga2:

Sequence; same for both SEQRES and ATOM records:

>d5elga2 a.45.1.0 (A:86-213) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dpplktpaefasvgsnifgtfgtflkskdsndgsehallvelealenhlkshdgpfiage
rvsavdlslapklyhlqvalghfkswsvpesfphvhnymktlfsldsfektkteekyvis
gwapkvnp

Timeline for d5elga2:

• d5elga2 is new in SCOPe 2.07-stable
  
• d5elga2 appears in the current release, SCOPe 2.08