SCOPe 2.07: Domain d5elga1: 5elg A:2-85

Lineage for d5elga1 (5elg A:2-85)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196344] (34 PDB entries)

8. Domain d5elga1: 5elg A:2-85 [345608]
   Other proteins in same PDB: d5elga2
   automated match to d5evoa1
   complexed with gol, gsh

Details for d5elga1

PDB Entry: 5elg, 1.81 Å

PDB Description: the structure of dhar1 from arabidopsis thaliana

PDB Compounds: (A:) Glutathione S-transferase DHAR1, mitochondrial

SCOPe Domain Sequences for d5elga1:

Sequence; same for both SEQRES and ATOM records:

>d5elga1 c.47.1.0 (A:2-85) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
aleicvkaavgapdhlgdcpfsqralltleeksltykihlinlsdkpqwfldispqgkvp
vlkiddkwvtdsdvivgileekyp

Timeline for d5elga1:

• d5elga1 is new in SCOPe 2.07-stable
  
• d5elga1 appears in the current release, SCOPe 2.08