SCOPe 2.08: Domain d3f52e_: 3f52 E:

Lineage for d3f52e_ (3f52 E:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.0: automated matches [191534] (1 protein)
   not a true family

6. Protein automated matches [190907] (21 species)
   not a true protein

7. Species Corynebacterium glutamicum [TaxId:1718] [346176] (2 PDB entries)

8. Domain d3f52e_: 3f52 E: [344713]
   automated match to d5woqa_
   complexed with gol

Details for d3f52e_

PDB Entry: 3f52, 1.75 Å

PDB Description: Crystal structure of the clp gene regulator ClgR from C. glutamicum

PDB Compounds: (E:) clp gene regulator (ClgR)

SCOPe Domain Sequences for d3f52e_:

Sequence; same for both SEQRES and ATOM records:

>d3f52e_ a.35.1.0 (E:) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
kapepllrealgaalrsfradkgvtlrelaeasrvspgylselergrkevssellasvch
algasvadvlieaagsma

Timeline for d3f52e_:

• d3f52e_ first appeared in SCOPe 2.07