SCOPe 2.07: Domain d2kbyd_: 2kby D:

Lineage for d2kbyd_ (2kby D:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.53: p53 tetramerization domain [47718] (1 superfamily)
   core: 4 helices; bundle

4. Superfamily a.53.1: p53 tetramerization domain [47719] (2 families)
   homotetramer

5. Family a.53.1.0: automated matches [259188] (1 protein)
   not a true family

6. Protein automated matches [259190] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [311354] (9 PDB entries)

8. Domain d2kbyd_: 2kby D: [344602]
   automated match to d5hobg_

Details for d2kbyd_

PDB Entry: 2kby

PDB Description: the tetramerization domain of human p73

PDB Compounds: (D:) Tumor protein p73

SCOPe Domain Sequences for d2kbyd_:

Sequence; same for both SEQRES and ATOM records:

>d2kbyd_ a.53.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dedtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqllqr

Timeline for d2kbyd_:

• d2kbyd_ is new in SCOPe 2.07-stable
  
• d2kbyd_ appears in the current release, SCOPe 2.08