PDB entry 2kby

View 2kby on RCSB PDB site
Description: The Tetramerization Domain of Human p73
Class: transcription
Keywords: tetramerization domain, Activator, Alternative splicing, Anti-oncogene, Apoptosis, Cell cycle, DNA-binding, Metal-binding, Nucleus, Phosphoprotein, Transcription, Transcription regulation, Ubl conjugation, Zinc
Deposited on 2008-12-12, released 2009-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-12-01, with a file datestamp of 2009-11-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor protein p73
    Species: Homo sapiens [TaxId:9606]
    Gene: P73, TP73
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Tumor protein p73
    Species: Homo sapiens [TaxId:9606]
    Gene: P73, TP73
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Tumor protein p73
    Species: Homo sapiens [TaxId:9606]
    Gene: P73, TP73
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2kbyc_
  • Chain 'D':
    Compound: Tumor protein p73
    Species: Homo sapiens [TaxId:9606]
    Gene: P73, TP73
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2kbyd_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >2kbyC (C:)
gsdedtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqllqr

    Sequence, based on observed residues (ATOM records): (download) 
    >2kbyC (C:)
dedtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqllqr

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >2kbyD (D:)
gsdedtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqllqr

    Sequence, based on observed residues (ATOM records): (download) 
    >2kbyD (D:)
dedtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqllqr