Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
Protein automated matches [190381] (11 species) not a true protein |
Species Vibrio cholerae [346239] (1 PDB entry) |
Domain d1tl0m_: 1tl0 M: [343584] automated match to d5lzia_ |
PDB Entry: 1tl0 (more details), 1.94 Å
SCOPe Domain Sequences for d1tl0m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tl0m_ b.40.2.1 (M:) automated matches {Vibrio cholerae} apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpgsqhids qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisma
Timeline for d1tl0m_: