Lineage for d1tl0d_ (1tl0 D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2397830Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2397831Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2398373Protein automated matches [190381] (11 species)
    not a true protein
  7. 2398488Species Vibrio cholerae [346239] (1 PDB entry)
  8. 2398489Domain d1tl0d_: 1tl0 D: [343581]
    automated match to d5lzia_

Details for d1tl0d_

PDB Entry: 1tl0 (more details), 1.94 Å

PDB Description: Novel carbohydrate binding site identified in a hybrid of cholera toxin and Escherichia coli heat-labile enterotoxin B-subunits: 1.9 crystal structure reveals the details
PDB Compounds: (D:) Cholera enterotoxin subunit B

SCOPe Domain Sequences for d1tl0d_:

Sequence, based on SEQRES records: (download)

>d1tl0d_ b.40.2.1 (D:) automated matches {Vibrio cholerae}
apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisma

Sequence, based on observed residues (ATOM records): (download)

>d1tl0d_ b.40.2.1 (D:) automated matches {Vibrio cholerae}
apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpgqkkaie
rmkdtlriaylteakveklcvwnnktpnsiaaisma

SCOPe Domain Coordinates for d1tl0d_:

Click to download the PDB-style file with coordinates for d1tl0d_.
(The format of our PDB-style files is described here.)

Timeline for d1tl0d_: