Lineage for d1liyc6 (1liy C:440-573)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2880867Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 2880868Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) (S)
  5. 2880869Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
    automatically mapped to Pfam PF02887
  6. 2880870Protein Pyruvate kinase, C-terminal domain [52937] (6 species)
  7. 2880891Species Human (Homo sapiens) [TaxId:9606] [82431] (8 PDB entries)
  8. 2880910Domain d1liyc6: 1liy C:440-573 [343523]
    Other proteins in same PDB: d1liya4, d1liya5, d1liyb4, d1liyc4, d1liyc5, d1liyd4, d1liyd5
    automated match to d2vggb3
    complexed with fbp, k, mn, pga; mutant

Details for d1liyc6

PDB Entry: 1liy (more details), 2.74 Å

PDB Description: Human erythrocyte pyruvate kinase: Arg479His mutant
PDB Compounds: (C:) Pyruvate kinase, isozymes R/L

SCOPe Domain Sequences for d1liyc6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1liyc6 c.49.1.1 (C:440-573) Pyruvate kinase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
elrraaplsrdptevtaigaveaafkccaaaiivltttghsaqllsryrpraaviavtrs
aqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgiesgklrgflrvgdlvivvtgwr
pgsgytnimrvlsi

SCOPe Domain Coordinates for d1liyc6:

Click to download the PDB-style file with coordinates for d1liyc6.
(The format of our PDB-style files is described here.)

Timeline for d1liyc6: