SCOPe 2.07: Domain d5xt5c_: 5xt5 C:

Lineage for d5xt5c_ (5xt5 C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.224: SufE/NifU [82648] (1 superfamily)
   alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123

4. Superfamily d.224.1: SufE/NifU [82649] (4 families)
   iron-sulfur cluster assembly proteins

5. Family d.224.1.2: NifU/IscU domain [102928] (5 proteins)

6. Protein automated matches [254586] (5 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [343280] (3 PDB entries)

8. Domain d5xt5c_: 5xt5 C: [343353]
   Other proteins in same PDB: d5xt5a1, d5xt5a2, d5xt5b_
   automated match to d1xjsa_
   complexed with plp, zn

Details for d5xt5c_

PDB Entry: 5xt5, 2.34 Å

PDB Description: sufs-sufu complex from bacillus subtilis

PDB Compounds: (C:) Zinc-dependent sulfurtransferase SufU

SCOPe Domain Sequences for d5xt5c_:

Sequence; same for both SEQRES and ATOM records:

>d5xt5c_ d.224.1.2 (C:) automated matches {Bacillus subtilis [TaxId: 224308]}
nldtlyrqvimdhyknprnkgvlndsivvdmnnptcgdrirltmkldgdivedakfegeg
csismasasmmtqaikgkdietalsmskifsdmmqgkeyddsidlgdiealqgvskfpar
ikcatlswkalekgv

Timeline for d5xt5c_:

• d5xt5c_ first appeared in SCOPe 2.06
  
• d5xt5c_ appears in the current release, SCOPe 2.08